PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca6608.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 292aa    MW: 33490.9 Da    PI: 6.715
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca6608.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.7e-5181321128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeelvv+yL++k++++++ +  +i+e+d+yk++Pw+Lp ++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   ++ 
  Dca6608.1   8 LPPGFRFHPTDEELVVHYLCRKCNSQSIYV-PIIAEIDLYKFDPWQLPDMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGK--PKTL 104
                79*************************999.88***************6666689*************************************98..778* PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfy g+ap+g kt+W+mheyrl
  Dca6608.1 105 GIKKALVFYAGKAPRGIKTNWIMHEYRL 132
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-624158IPR003441NAC domain
PROSITE profilePS5100559.8738158IPR003441NAC domain
PfamPF023651.3E-279132IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSNQQISLPP GFRFHPTDEE LVVHYLCRKC NSQSIYVPII AEIDLYKFDP WQLPDMALYG  60
EKEWYFFSPR DRKYPNGSRP NRAAGTGYWK ATGADKPIGK PKTLGIKKAL VFYAGKAPRG  120
IKTNWIMHEY RLANVDRSAG KKTNLRLDDW VLCRIYNKKG SIEKGHDIDQ KLMQQHFEFE  180
DQKPVISTRD NLIAPVGYPN QSPMGVSPPP FKNEAMHFDT SDSVPHCHTD DTSGSGLVAS  240
PEFICDKEVQ SEAKWAQQLD AALEYPFDYM DPFTDDPFVT SAQFQDMFMQ FR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-8321649174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010674351.11e-160PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-116NAC2_ARATH; NAC domain-containing protein 2
TrEMBLA0A0J8CPM61e-160A0A0J8CPM6_BETVU; Uncharacterized protein
STRINGVIT_07s0031g02610.t011e-135(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-118NAC family protein